Glis1 Rabbit Polyclonal Antibody

SKU TA329588

Rabbit polyclonal anti-Glis1 antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Glis1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: DKRPKEAPGAPGQGRGPVSLGAHMAFRIAVSGGGCGDGNPLDLLPRLPVP
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 84 kDa
• Gene Name: GLIS family zinc finger 1
• Database Link:
  NP_671754
  Q8K1M4
• Background: Glis1 acts as both a repressor and activator of transcription. Glis1 binds to the consensus sequence 5'-GACCACCCAC-3'.
• Synonyms: FLJ36155; Gli5-like; Glis1-like
• Note: Immunogen sequence homology: Mouse: 100%; Rat: 93%; Dog: 91%; Rabbit: 86%; Pig: 79%; Bovine: 79%

Reference Data