B3GNT7 Rabbit Polyclonal Antibody

CAT#: TA329585

Rabbit polyclonal anti-B3GNT7 antibody

Product Images

WB Suggested Anti-B3GNT7 Antibody Titration: 0.2-1 ug/ml; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-B3GNT7 antibody: synthetic peptide directed towards the N terminal of human B3GNT7. Synthetic peptide located within the following region: QFLFYRHCRYFPMLLNHPEKCRGDVYLLVVVKSVITQHDRREAIRQTWGR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 46 kDa
• Gene Name: UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7
• Database Link:
  NP_660279
  Entrez Gene 93010 Human
  UniProt ID Q8NFL0
• Background: B3GNT7 belongs to the glycosyltransferase 31 family. It may be involved in keratane sulfate biosynthesis. B3GNT7 transfers N-acetylgalactosamine on to keratan sulfate-related glycans. It may play a role in preventing cells from migrating out of the original tissues and invading surrounding tissues.
• Synonyms: beta3GnT7
• Note: Immunogen sequence homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Mouse: 93%; Bovine: 86%; Zebrafish: 79%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: Keratan sulfate biosynthesis, Metabolic pathways