PNPLA5 Rabbit Polyclonal Antibody

SKU TA329580

Rabbit polyclonal anti-PNPLA5 antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PNPLA5 antibody: synthetic peptide directed towards the C terminal of human PNPLA5. Synthetic peptide located within the following region: NMALEVFSRTKAQLLGPISPPATRVLETSPLQPQIAPHREELGPTHQA
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 48 kDa
• Gene Name: patatin like phospholipase domain containing 5
• Database Link:
  NP_620169
  Q7Z6Z6
• Background: Human patatin-like phospholipases, such as PNPLA5, have been implicated in regulation of adipocyte differentiation and have been induced by metabolic stimuli.Human patatin-like phospholipases, such as PNPLA5, have been implicated in regulation of adipocyte differentiation and have been induced by metabolic stimuli (Wilson et al., 2006 [PubMed 16799181]). [supplied by OMIM].Human patatin-like phospholipases, such as PNPLA5, have been implicated in regulation of adipocyte differentiation and have been induced by metabolic stimuli (Wilson et al., 2006 [PubMed 16799181]). [supplied by OMIM]
• Synonyms: dJ388M5; dJ388M5.4; GS2L
• Note: Immunogen sequence homology: Human: 100%

Reference Data