B3GNT6 Rabbit Polyclonal Antibody

SKU TA329578

Rabbit polyclonal anti-B3GNT6 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-B3GNT6 antibody is: synthetic peptide directed towards the C-terminal region of Human B3GNT6. Synthetic peptide located within the following region: CSGGGFLLSGLAPSGHEGIRPFGVQLPGAQQSSFDPCMYRELLLVHRFAP
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 29 kDa
• Gene Name: UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 6
• Database Link:
  NP_619651
  Q6ZMB0
• Background: B3GNT6 is a beta-1,3-N-acetylglucosaminyltransferase that synthesizes the core 3 structure of the O-glycan, an important precursor in the biosynthesis of mucin-type glycoproteins. It plays an important role in the synthesis of mucin-type O-glycans in digestive organs.
• Synonyms: 3-Gn-T6; B3Gn-T6; beta-1; beta3Gn-T6; BGnT-6
• Note: Immunogen sequence homology: Horse: 100%; Human: 100%; Rabbit: 93%; Rat: 92%; Dog: 86%; Pig: 86%; Bovine: 86%; Mouse: 83%

Reference Data

• Protein Pathways: Metabolic pathways, O-Glycan biosynthesis