ART5 Rabbit Polyclonal Antibody

SKU TA329569

Rabbit polyclonal anti-ART5 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ART5 antibody is: synthetic peptide directed towards the N-terminal region of Human ART5. Synthetic peptide located within the following region: HALLRESWEAAQETWEDKRRGLTLPPGFKAQNGIAIMVYTNSSNTLYWEL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 26 kDa
• Gene Name: ADP-ribosyltransferase 5
• Database Link:
  NP_001073004
  Q96L15
• Background: The function of this protein remains unknown.
• Synonyms: ARTC5
• Note: Immunogen sequence homology: Rat: 100%; Human: 100%; Dog: 92%; Pig: 92%; Horse: 92%; Guinea pig: 92%; Bovine: 91%; Rabbit: 85%

Reference Data

• Protein Families: Secreted Protein