Alx1 Rabbit Polyclonal Antibody

SKU TA329550

Rabbit Polyclonal anti-Alx1 antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Alx1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: MEFLSEKFALKSPPSKNSDFYMGTGGALEHVMETLDNESFYGKATAGKCV
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 37 kDa
• Gene Name: ALX homeobox 1
• Database Link:
  NP_766141
  Q8C8B0
• Background: Alx1 is a transcriptional activator that acts at a palindromic recognition sequence to enhance the activity of the SV40 and TK promoters. Alx1 may play a role in chondrocyte differentiation and may also influence cervix development.
• Synonyms: CART-1; CART1
• Note: Immunogen sequence homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%

Reference Data