AHNAK2 Rabbit Polyclonal Antibody

SKU
TA329530
Rabbit Polyclonal anti-AHNAK2 antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-AHNAK2 antibody: synthetic peptide directed towards the middle region of human AHNAK2. Synthetic peptide located within the following region: AATRVCRTGRSRWRDVCRNFMRRYQSRVIQGLVAGETAQQICEDLRLCIP
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 85 kDa
Gene Name AHNAK nucleoprotein 2
Database Link
Background The specific function of AHNAK2 is not yet known.
Synonyms C14orf78
Note Immunogen sequence homology: Human: 100%; Yeast: 83%
Reference Data
Write Your Own Review
You're reviewing:AHNAK2 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.