Glyt1 (SLC6A9) Rabbit Polyclonal Antibody

SKU TA329523

Rabbit Polyclonal anti-SLC6A9 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC6A9 antibody is: synthetic peptide directed towards the N-terminal region of Human SLC6A9. Synthetic peptide located within the following region: ARPRMAAAHGPVAPSSPEQNGAVPSEATKRDQNLKRGNWGNQIEFVLTSV
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 72 kDa
• Gene Name: solute carrier family 6 member 9
• Database Link:
  NP_964012
  P48067
• Background: SLC6A9 terminates the action of glycine by its high affinity sodium-dependent reuptake into presynaptic terminals. It may play a role in regulation of glycine levels in NMDA receptor-mediated neurotransmission.
• Synonyms: GLYT1
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Human: 100%; Rabbit: 100%; Guinea pig: 100%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%

Reference Data

• Protein Families: Druggable Genome, Transmembrane