GPR87 Rabbit Polyclonal Antibody

SKU TA329468

Rabbit Polyclonal anti-GPR87 antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GPR87 antibody: synthetic peptide directed towards the N terminal of human GPR87. Synthetic peptide located within the following region: MGFNLTLAKLPNNELHGQESHNSGNRSDGPGKNTTLHNEFDTIVLPVLYL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 41 kDa
• Gene Name: G protein-coupled receptor 87
• Database Link:
  NP_076404
  Q9BY21
• Background: G protein-coupled receptors play a role in cell communication. They are characterized by an extracellular N terminus, 7 transmembrane regions, and an intracellular C terminus.
• Synonyms: FKSG78; GPR95; KPG_002
• Note: Immunogen sequence homology: Human: 100%; Dog: 77%

Reference Data

• Protein Families: Druggable Genome, GPCR, Transmembrane