C13orf8 (CHAMP1) Rabbit Polyclonal Antibody

SKU TA329439

Rabbit Polyclonal anti-ZNF828 antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-C13ORF8 antibody: synthetic peptide directed towards the middle region of human C13ORF8. Synthetic peptide located within the following region: PAASPESRKSARTTSPEPRKPSPSESPEPWKPFPAVSPEPRRPAPAVSPG
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 89 kDa
• Gene Name: chromosome alignment maintaining phosphoprotein 1
• Database Link:
  NP_115812
  Q96JM3
• Background: The function of the C13orf8 gene has not yet been determined.
• Synonyms: C13orf8; CAMP; CHAMP; ZNF828
• Note: Immunogen sequence homology: Horse: 100%; Human: 100%; Dog: 93%; Rat: 93%; Rabbit: 93%; Pig: 86%; Mouse: 86%

Reference Data