ZNF471 Rabbit Polyclonal Antibody

SKU TA329418

Rabbit Polyclonal Anti-ZNF471 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ZNF471 antibody is: synthetic peptide directed towards the C-terminal region of Human ZNF471. Synthetic peptide located within the following region: KPYECNECGKAFSQTSNLTQHQRIHTGEKPYKCTECGKAFSDSSSCAQHQ
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 68 kDa
• Gene Name: zinc finger protein 471
• Database Link:
  NP_065864
  Q9BX82
• Background: ZNF471 may be involved in transcriptional regulation.
• Synonyms: ERP1; Z1971
• Note: Immunogen sequence homology: Dog: 100%; Rat: 100%; Human: 100%; Bovine: 100%; Pig: 92%; Horse: 92%; Rabbit: 92%; Guinea pig: 92%; Mouse: 85%

Reference Data

• Protein Families: Transcription Factors