SSBP2 Rabbit Polyclonal Antibody

SKU TA329410

Rabbit Polyclonal anti-SSBP2 antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SSBP2 antibody: synthetic peptide directed towards the N terminal of human SSBP2. Synthetic peptide located within the following region: YPGGPRPPLRIPNQALGGVPGSQPLLPSGMDPTRQQGHPNMGGPMQRMTP
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 38 kDa
• Gene Name: single stranded DNA binding protein 2
• Database Link:
  NP_036578
  P81877
• Background: SSBP2 is a member of a closely related, evolutionarily conserved, and ubiquitously expressed gene family. It is also a potential tumor suppressor.
• Synonyms: HSPC116; SOSS-B2
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 92%

Reference Data

• Protein Families: Transcription Factors