KIN Rabbit Polyclonal Antibody

CAT#: TA329385

Rabbit Polyclonal anti-KIN antibody

Product Images

WB Suggested Anti-KIN Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:2500; Positive Control: HepG2 cell lysateKIN is supported by BioGPS gene expression data to be expressed in HepG2

• 

  Human Spermatophore

• 

  Human kidney

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-KIN antibody: synthetic peptide directed towards the middle region of human KIN. Synthetic peptide located within the following region: LKTIGSSASVKRKESSQSSTQSKEKKKKKSALDEIMEIEEEKKRTARTDY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 45 kDa
• Gene Name: Kin17 DNA and RNA binding protein
• Database Link:
  NP_036443
  Entrez Gene 22944 Human
  UniProt ID O60870
• Background: Kin is a nuclear protein that forms intranuclear foci during proliferation and is redistributed in the nucleoplasm during the cell cycle. Short-wave ultraviolet light provokes the relocalization of the protein, suggesting its participation in the cellular response to DNA damage. Originally selected based on protein-binding with RecA antibodies, the mouse protein presents a limited similarity with a functional domain of the bacterial RecA protein, a characteristic shared by the human ortholog.
• Synonyms: BTCD; KIN17; Rts2
• Note: Immunogen sequence homology: Horse: 100%; Human: 100%; Dog: 85%; Pig: 85%; Rat: 85%; Bovine: 85%; Rabbit: 85%; Guinea pig: 85%