FGD1 Rabbit Polyclonal Antibody

SKU TA329379

Rabbit Polyclonal anti-FGD1 antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FGD1 antibody: synthetic peptide directed towards the C terminal of human FGD1. Synthetic peptide located within the following region: WMAVLGRAGRGDTFCPGPTLSEDREMEEAPVAALGATAEPPESPQTRDKT
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 107 kDa
• Gene Name: FYVE, RhoGEF and PH domain containing 1
• Database Link:
  NP_004454
  P98174
• Background: FGD1 contains Dbl (DH) and pleckstrin (PH) homology domains. It can bind specifically to the Rho family GTPase Cdc42Hs and stimulate the GDP-GTP exchange of the isoprenylated form of Cdc42Hs. It also stimulates the mitogen activated protein kinase cascade leading to c-Jun kinase SAPK/JNK1 activation. FGD1 has an essential role in embryonic development, and FGD1 gene mutations result in the human developmental disorder, Aarskog-Scott syndrome.
• Synonyms: AAS; FGDY; MRXS16; ZFYVE3
• Note: Immunogen sequence homology: Human: 100%; Dog: 86%; Pig: 86%; Rat: 86%; Mouse: 86%; Bovine: 86%; Horse: 79%; Rabbit: 79%

Reference Data

• Protein Pathways: Regulation of actin cytoskeleton