Zbtb7c Rabbit Polyclonal Antibody

SKU TA329367

Rabbit Polyclonal Anti-Zbtb7c Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Mouse
• Antibody Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Zbtb7c antibody is: synthetic peptide directed towards the middle region of Mouse Zbtb7c. Synthetic peptide located within the following region: QDITCPQSPSKTDHLTEKDYSDTPRDFPDSFQPGSPGHLGVIRDFSIESL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 69 kDa
• Gene Name: zinc finger and BTB domain containing 7C
• Database Link:
  NP_663331
  Q8VCZ7
• Background: Zbtb7c may be a tumor suppressor gene.
• Synonyms: APM-1; APM1; B230208J24Rik; FLJ37907; ZBTB36; ZNF857C
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Guinea pig: 100%; Mouse: 93%; Goat: 86%; Bovine: 86%; Rabbit: 86%

Reference Data