ZNF475 (ZFP1) Rabbit Polyclonal Antibody

SKU TA329342

Rabbit Polyclonal anti-ZFP1 antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZFP1 antibody: synthetic peptide directed towards the N terminal of human ZFP1. Synthetic peptide located within the following region: SNRSYAGKQTDECNEFGKALLYLKQEKTHSGVEYSEYNKSGKALSHKAAI
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 41 kDa
• Gene Name: ZFP1 zinc finger protein
• Database Link:
  NP_710155
  Q6P2D0
• Background: Zinc finger proteins (Zfp) are encoded by a large family of genes present in many organisms including yeast and human. Some of them are transcriptional activators and bind specifically to DNA by zinc mediated folded structures commonly known as zinc fingers. The putative Zfp-1 (Zinc finger protein 1 homolog) protein contains in addition to 7 zinc fingers, two helix-turn-helix motifs.
• Synonyms: ZNF475
• Note: Immunogen sequence homology: Human: 100%; Bovine: 92%; Dog: 86%; Rat: 86%; Mouse: 79%

Reference Data

• Protein Families: Transcription Factors