ZFP90 Rabbit Polyclonal Antibody

SKU TA329338

Rabbit Polyclonal anti-ZFP90 antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZFP90 antibody: synthetic peptide directed towards the middle region of human ZFP90. Synthetic peptide located within the following region: QEECGGAQSLGNCDQVLRGYQVSKPEVIFKLEQGEEPWISEGEIQRPFYP
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 90 kDa
• Gene Name: ZFP90 zinc finger protein
• Database Link:
  NP_597715
  Q8TF47
• Background: ZFP90 may function as a repressor or silencer protein, and most likely exerts its repressing activity upon zinc-dependent binding to DNA. It may be involved in proper spermatogenesis by repressing the expression of genes unnecessary or incompatible with the maintenance of a haploid cell state.
• Synonyms: FIK; NK10; zfp-90; ZNF756

Reference Data