SALF (STON1-GTF2A1L) Rabbit Polyclonal Antibody

CAT#: TA329314

Rabbit Polyclonal anti-SALF antibody

Product Images

WB Suggested Anti-SALF Antibody Titration: 5.0ug/ml; ELISA Titer: 1:62500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SALF antibody: synthetic peptide directed towards the C terminal of human SALF. Synthetic peptide located within the following region: NSGDDVSEQDVPDLFDTDNVIVCQYDKIHRSKNKWKFYLKDGVMCFGGRD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 132 kDa
• Gene Name: STON1-GTF2A1L readthrough
• Database Link:
  NP_758515
  Entrez Gene 286749 Human
  UniProt ID Q9Y6Q2
• Background: The SALF mRNA is an infrequent but naturally occurring co-transcribed product of the neighboring SBLF and ALF genes. This rare transcript encodes a fusion protein composed of greater than 95% each of the individual elements, stoned B-like factor (SBLF) and TFIIA-alpha/beta-like factor (ALF). The significance of this co-transcribed mRNA and the function of its protein product have not yet been determined.
• Synonyms: SALF
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 86%; Zebrafish: 79%

Reference Data

• Protein Families: Transcription Factors