KLF1 Rabbit Polyclonal Antibody

SKU TA329307

Rabbit Polyclonal anti-KLF1 antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-KLF1 antibody: synthetic peptide directed towards the middle region of human KLF1. Synthetic peptide located within the following region: PKALALQPVYPGPGAGSSGGYFPRTGLSVPAASGAPYGLLSGYPAMYPAP
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 38 kDa
• Gene Name: Kruppel-like factor 1 (erythroid)
• Database Link:
  NP_006554
  Q13351
• Background: KLF1 is a transcription factor, originally identified in this laboratory, which plays a crucial role as a transcriptional activator at the adult beta-globin locus.
• Synonyms: CDAN4; EKLF; HBFQTL6; INLU
• Note: Immunogen sequence homology: Human: 100%; Bovine: 93%; Rat: 92%; Mouse: 92%; Dog: 85%; Pig: 85%

Reference Data

• Protein Families: Transcription Factors