YY1 associated factor 2 (YAF2) Rabbit Polyclonal Antibody

SKU TA329295

Rabbit Polyclonal anti-YAF2 antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-YAF2 antibody: synthetic peptide directed towards the middle region of human YAF2. Synthetic peptide located within the following region: KGTSTRKPRPVSQLVAQQVTQQFVPPTQSKKEKKDKVEKEKSEKETTSKK
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 20 kDa
• Gene Name: YY1 associated factor 2
• Database Link:
  NP_005739
  Q8IY57
• Background: YAF2 interacts with YY1, a zinc finger protein involved in negative regulation of muscle-restricted genes. YAF2 contains a single N-terminal C2-X10-C2 zinc finger, and in contrast to YY1, is up-regulated during myogenic differentiation. It also facilitates proteolytic cleavage of YY1 by the calcium- activated protease, m-calpain, suggesting a mechanism by which this protein antagonizes the negative effect of YY1.The protein encoded by this gene interacts with YY1, a zinc finger protein involved in negative regulation of muscle-restricted genes. This gene product itself contains a single N-terminal C2-X10-C2 zinc finger, and in contrast to YY1, is up-regulated during myogenic differentiation. It also facilitates proteolytic cleavage of YY1 by the calcium- activated protease, m-calpain, suggesting a mechanism by which this protein antagonizes the negative effect of YY1. Multiple transcript variants encoding different isoforms have been found for this gene, but the full-length nature of only two have been confirmed to date.
• Synonyms: DKFZp779H1820; MGC41856
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 93%; Mouse: 86%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors