TSFM Rabbit Polyclonal Antibody

SKU TA329293

Rabbit Polyclonal anti-TSFM antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TSFM antibody: synthetic peptide directed towards the middle region of human TSFM. Synthetic peptide located within the following region: GTMMHCQTLKDQPSAYSKGFLNSSELSGLPAGPDREGSLKDQLALAIGKL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 38 kDa
• Gene Name: Ts translation elongation factor, mitochondrial
• Database Link:
  NP_005717
  P43897
• Background: The TSFM protein is a mitochondrial translation elongation factor. Synthesis of the 13 mitochondrial-encoded proteins occurs on a dedicated mitochondrial translation apparatus similar to that found in prokaryotes and requires, in addition to the tRNAs and rRNAs encoded in mtDNA, the concerted action of several translation factors and a large number of mitochondrial ribosomal proteins, all of which are encoded by nuclear genes.Synthesis of the 13 mitochondrial-encoded proteins occurs on a dedicated mitochondrial translation apparatus similar to that found in prokaryotes and requires, in addition to the tRNAs and rRNAs encoded in mtDNA, the concerted action of several translation factors and a large number of mitochondrial ribosomal proteins, all of which are encoded by nuclear genes. The TSFM gene encodes a mitochondrial translation elongation factor (Smeitink et al., 2006 [PubMed 17033963]). [supplied by OMIM]
• Synonyms: EFTS; EFTSMT
• Note: Immunogen sequence homology: Human: 100%; Rat: 93%; Rabbit: 93%; Pig: 86%; Mouse: 86%; Bovine: 86%; Guinea pig: 86%

Reference Data

• Protein Families: Transcription Factors