CP2c (TFCP2) Rabbit Polyclonal Antibody

CAT#: TA329205

Rabbit Polyclonal anti-TFCP2 antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (2)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00


Transient overexpression lysate of transcription factor CP2 (TFCP2), transcript variant 2
    • 100 ug

USD 436.00

Other products for "CP2c"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-TFCP2 antibody: synthetic peptide directed towards the N terminal of human TFCP2. Synthetic peptide located within the following region: YSMSDVLALPIFKQEESSLPPDNENKILPFQYVLCAATSPAVKLHDETLT
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 57 kDa
Gene Name transcription factor CP2
Background TFCP2 binds a variety of cellular and viral promoters including fibrinogen, alpha-globin, SV40 and HIV-1 promoters. Activation of the alpha-globin promoter in erythroid cells is via synergistic interaction with UBP1. It also functions as part of the SSP (stage selector protein) complex. TFCP2 facilitates the interaction of the gamma-globin genes with enhancer elements contained in the locus control region in fetal erythroid cells. It interacts by binding to the stage selector element (SSE) in the proximal gamma-globin promoter.
Synonyms LBP1C; LSF; LSF1D; SEF; TFCP2C
Note Immunogen sequence homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Rat: 93%; Guinea pig: 92%
Reference Data
Protein Families Transcription Factors

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.