MRP1 (ABCC1) Mouse Monoclonal Antibody [Clone ID: IU5C1]

SKU TA309560

Mouse Monoclonal MRP1 Antibody (IU5C1)

Product Data

• Clone Name: IU5C1
• Application: ICC/IF, IHC, WB
• Recommended Dilution: Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin: 1:200, Immunohistochemistry: 1:200, Western Blot: 1:250 - 1:500
• Reactivity: Human, Mouse
• Antibody Host: Mouse
• Isotype: IgG1
• Clonality: Monoclonal
• Immunogen: A recombinant peptide corresponding to residues 1-33 (N-terminal: SMALRGFCSADGSDPLWDWNVTWNTSNPDFTKCF) of the human protein. [Swiss-Prot# P33527]
• Buffer: 0.1% Sodium Azide
• Purification: Ascites
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Gene Name: ATP binding cassette subfamily C member 1
• Database Link:
  NP_004987
  P33527
• Synonyms: ABC29; ABCC; GS-X; MRP; MRP1

Reference Data

• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: ABC transporters