Reep1 Mouse Monoclonal Antibody [Clone ID: N345/51]

SKU
75-313
Reep1 mouse monoclonal antibody, clone N345/51
$700.00
3 Weeks*
Specifications
Product Data
Clone Name N345/51
Application IF, IHC, WB
Recommended Dilution Immunoblot (IB).
Immunocytochemistry (ICC).
Immunohistochemistry (IHC).
Reactivity Mouse, Rat
Antibody Host Mouse
Isotype IgG2b
Clonality Monoclonal
Immunogen Fusion protein amino acids 111-201 (KDRSYDALVHFGKRGLNVAATAAVMAASKGQGALSERLRSFSMQDLTTIRGDGAPAPSGPPPPGTGRSSGKHSQPKMSRSASESAGSSGTA, cytoplasmic C-terminus) of mouse REEP1 (also known as Receptor expression-enhancing protein 1, C2orf23, D6Ertd253e and rCG_56072, accession number Q8BGH4).
Rat: 97% identity (89/91 amino acids identical)
Human: 95% identity (87/91 amino acids identical)
Buffer State: Purified
Conjugation Unconjugated
Shipping Blue Ice
Gene Name receptor accessory protein 1
Database Link
Synonyms C2orf23
Note USERS will cite the UC Davis/NIH NeuroMab Facility in any publication(s) describing the research utilizing the MATERIALS. The suggested acknowledgment statement is as follows:
"The monoclonal antibody _ was developed by and/or obtained from the UC Davis/NIH NeuroMab Facility, supported by NIH grant U24NS050606 and maintained by the Department of Neurobiology, Physiology and Behavior, College of Biological Sciences, University of California, Davis, CA 95616."
Also, please include the complete clone number (e.g., N52A/42) and the Antibody Registry identification number (e.g., RRID:AB_2120479) to avoid ambiguity.
View Research License Agreement
Reference Data
Write Your Own Review
You're reviewing:Reep1 Mouse Monoclonal Antibody [Clone ID: N345/51]
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.