Rabbit Polyclonal TGN46 Antibody
| Applications | FC, ICC/IF, IHC, Immunoblotting, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A genomic peptide made to an internal region of the human TGOLN2 protein (within residues 200-350). [Swiss-Prot O43493] |
Rabbit Polyclonal antibody to GOLPH2 (golgi membrane protein 1)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 339 and 401 of GOLPH2 (Uniprot ID#Q8NBJ4) |
Rabbit Polyclonal antibody to FTCD (formiminotransferase cyclodeaminase)
| Applications | IHC, WB |
| Reactivities | Human, Mouse (Predicted: Pig, Rat, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 251 of FTCD (Uniprot ID#O95954) |
Rabbit Polyclonal Anti-GOLGB1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GOLGB1 antibody: synthetic peptide directed towards the N terminal of human GOLGB1. Synthetic peptide located within the following region: NKYIEEMKAQGGTVLPTEPQSEEQLSKHDKSSTEEEMEIEKIKHKLQEKE |
Rabbit Polyclonal Anti-TGOLN2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TGOLN2 antibody: synthetic peptide directed towards the N terminal of human TGOLN2. Synthetic peptide located within the following region: PSAGNVSTHPSLSQRPGGSTKSHPEPQTPKDSPSKSSAEAQTPEDTPNKS |
Germany
Japan
United Kingdom
China
