Centrosome Marker Antibodies

Jump to Filters
View as table Download
beta Catenin (CTNNB1) Goat Polyclonal Antibody
AB0095-200

USD 355.00

In Stock

Goat Polyclonal Anti-beta-Catenin Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 731 aa to the C-terminus of human beta Catenin produced in E. coli.
CTNNBL1 Rabbit Polyclonal Antibody
TA319966

USD 570.00

2 Weeks

Rabbit Polyclonal CTTNBL1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen CTTNBL1 antibody was raised against a 20 amino acid synthetic peptide near the carboxy terminus of human CTTNBL1.
MEK1 (MAP2K1) Rabbit Polyclonal Antibody
TA321522

USD 380.00

In Stock

Anti-MAP2K1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 15-28 amino acids of human mitogen-activated protein kinase kinase 1
Pericentrin 1 (NUP85) Goat Polyclonal Antibody
TA302681

USD 520.00

In Stock

Goat Polyclonal Antibody against Pericentrin 1 / NUP85

Applications FC, IF, PEP-ELISA, WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat)
Conjugation Unconjugated
Immunogen Peptide with sequence C-ARAIIREGSLEGS, from the C Terminus of the protein sequence according to NP_079120.
beta Synuclein (SNCB) Rabbit Polyclonal Antibody
TA312076

USD 380.00

2 Weeks

Rabbit polyclonal Synuclein beta antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Synuclein β antibody.
CDK1 Rabbit Polyclonal Antibody
TA374547

USD 450.00

3 Weeks

Phospho-CDK1-Y15 Rabbit polyclonal Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic phosphorylated peptide around Y15 of human CDK1 (NP_001777.1).
Modifications Phospho Y15
G protein alpha inhibitor 1 (GNAI1) Rabbit Polyclonal Antibody
TA335036

USD 539.00

5 Days

Rabbit Polyclonal Anti-GNAI1 Antibody

Applications WB
Reactivities Mouse, Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-GNAI1 antibody: synthetic peptide directed towards the middle region of human GNAI1. Synthetic peptide located within the following region: YQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTFKDLH
G protein alpha Inhibitor 2 (GNAI2) Rabbit Polyclonal Antibody
TA376634

USD 365.00

3 Weeks

GNAI2 Rabbit polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-355 of human GNAI2 (NP_002061.1).
Modifications Unmodified
CDK2 Rabbit Monoclonal Antibody [Clone ID: R04-1D5]
TA383966

USD 380.00

4 Weeks

CDK2 Rabbit monoclonal Antibody

Applications IF, IHC, IP, WB
Reactivities Human, Rat, Hamster
Conjugation Unconjugated
PLK1 Rabbit Polyclonal Antibody
TA327377

USD 365.00

In Stock

PLK1 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PLK1
IL20 Rabbit Polyclonal Antibody
TA349271

USD 380.00

In Stock

Rabbit Polyclonal Anti-CDK2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CDK2
G protein alpha Inhibitor 2 (GNAI2) Rabbit Polyclonal Antibody
TA367570

USD 380.00

4 Weeks

GNAI2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human GNAI2
MEK1 (MAP2K1) Rabbit Polyclonal Antibody
TA368844

USD 380.00

4 Weeks

MAP2K1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human MAP2K1
MEK1 (MAP2K1) Rabbit Polyclonal Antibody
TA384707

USD 380.00

4 Weeks

MEK1/2 Rabbit polyclonal Antibody

Applications IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human MEK1/2