Rabbit Polyclonal Anti-Zbtb7c Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Zbtb7c antibody is: synthetic peptide directed towards the middle region of Mouse Zbtb7c. Synthetic peptide located within the following region: QDITCPQSPSKTDHLTEKDYSDTPRDFPDSFQPGSPGHLGVIRDFSIESL |
Rabbit Polyclonal Anti-ZBTB7C Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ZBTB7C Antibody: synthetic peptide directed towards the N terminal of human ZBTB7C. Synthetic peptide located within the following region: MANDIDELIGIPFPNHSSEVLCSLNEQRHDGLLCDVLLVVQEQEYRTHRS |
Germany
Japan
United Kingdom
China