Antibodies

Jump to Filters
View as table Download
Reep1 Mouse Monoclonal Antibody [Clone ID: N345/51]
75-313

USD 640.00

3 Weeks

Reep1 mouse monoclonal antibody, clone N345/51

Applications IF, IHC, WB
Reactivities Mouse, Rat
Conjugation Unconjugated
REEP1 Rabbit Polyclonal Antibody
TA338628

USD 539.00

5 Days

Rabbit Polyclonal Anti-REEP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-REEP1 antibody: synthetic peptide directed towards the C terminal of human REEP1. Synthetic peptide located within the following region: ERLRSFSMQDLTTIRGDGAPAPSGPPPPGSGRASGKHGQPKMSRSASESA
REEP1 Rabbit Polyclonal Antibody
TA338627

USD 539.00

5 Days

Rabbit Polyclonal Anti-REEP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-REEP1 antibody: synthetic peptide directed towards the middle region of human REEP1. Synthetic peptide located within the following region: AKDRSYDALVHFGKRGLNVAATAAVMAASKGQGALSERLRSFSMQDLTTI