REEP1 Rabbit Polyclonal Antibody

CAT#: TA338628

Rabbit Polyclonal Anti-REEP1 Antibody

Product Images

WB Suggested Anti-REEP1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: Human Muscle

• 

  Host: Rabbit; Target Name: REEP1; Sample Tissue: Human Fetal Brain; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-REEP1 antibody: synthetic peptide directed towards the C terminal of human REEP1. Synthetic peptide located within the following region: ERLRSFSMQDLTTIRGDGAPAPSGPPPPGSGRASGKHGQPKMSRSASESA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 22 kDa
• Gene Name: receptor accessory protein 1
• Database Link:
  NP_075063
  Entrez Gene 65055 Human
  UniProt ID Q9H902
• Background: REEP1 belongs to the DP1 family and may enhance the cell surface expression of odorant receptors.
• Synonyms: C2orf23; HMN5B; SPG31
• Note: Immunogen Sequence Homology: Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Pig: 92%; Bovine: 92%; Guinea pig: 92%; Dog: 86%

Reference Data

• Protein Families: Druggable Genome, Transmembrane