Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 11 of 11 results

(reset)

PTCH1 Mouse Monoclonal Antibody [Clone ID: OTI5C7]

TA500123

USD 478.00

In Stock

Patched1 (Patched) mouse monoclonal antibody, clone OTI5C7 (formerly 5C7)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

PTCH1 Mouse Monoclonal Antibody [Clone ID: OTI5C7]

CF500123

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) Patched1 mouse monoclonal antibody, clone OTI5C7 (formerly 5C7)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

PTCH1 Mouse Monoclonal Antibody [Clone ID: OTI5C7]

TA500123S

USD 200.00

In Stock

Patched1 (Patched) mouse monoclonal antibody, clone OTI5C7 (formerly 5C7)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

PTCH1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5C7]

TA500123AM

USD 509.00

In Stock

Patched1 (Patched) mouse monoclonal antibody, clone OTI5C7 (formerly 5C7), Biotinylated

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

PTCH1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5C7]

TA500123BM

USD 509.00

2 Weeks

Patched1 (Patched) mouse monoclonal antibody, clone OTI5C7 (formerly 5C7), HRP conjugated

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

PTCH1 Rabbit Polyclonal Antibody

TA385073

USD 380.00

4 Weeks

PTCH1 Rabbit polyclonal Antibody

Applications	ELISA, IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from human Patched. AA range:1-50

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

PTCH1 (C-term) Goat Polyclonal Antibody

AP22448PU-N

USD 520.00

5 Days

PTCH1 (C-term) goat polyclonal antibody, Aff - Purified

Applications	ELISA, IF, IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Peptide with sequence from the C Terminus of Human PTCH1 (NP_001077073.1, NP_001077074.1, NP_001077075.1, NP_001077076.1)

PTCH1 Rabbit Polyclonal Antibody

TA380484

USD 365.00

3 Weeks

PTCH1 Rabbit polyclonal Antibody

Applications	ICC/IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1214-1312 of human PTCH1 (NP_000255.2).
Modifications	Unmodified

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

PTCH1 Rabbit Polyclonal Antibody

AP06278PU-N

USD 465.00

3 Weeks

PTCH1 rabbit polyclonal antibody, Aff - Purified

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide, corresponding to the N-terminal of Human Patched.

1 / 2

2 / 2

Previous Next

PTCH1 Rabbit Polyclonal Antibody

TA334665

USD 539.00

5 Days

Rabbit Polyclonal Anti-PTCH1 Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-PTCH1 antibody: synthetic peptide directed towards the C terminal of human PTCH1. Synthetic peptide located within the following region: TILGVLNGLVLLPVLLSFFGPYPEVSPANGLNRLPTPSPEPPPSVVRFAM

1 / 2

2 / 2

Previous Next

Ptch1 Rabbit Polyclonal Antibody

AP55224SU-N

USD 655.00

5 Weeks

Ptch1 rabbit polyclonal antibody, Serum

Applications	ELISA, IHC, WB
Reactivities	Mouse
Conjugation	Unconjugated
Immunogen	Synthetic peptide derived from N-term domain of mouse PTC1

1 - 11 of 11 results