Rabbit Polyclonal TBX21 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | TBX21 antibody was raised against a 19 amino acid peptide near the carboxy terminus of human TBX2. |
Rabbit Polyclonal TBX21 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | TBX21 antibody was raised against a 19 amino acid peptide near the carboxy terminus of human TBX2. |
Rabbit Polyclonal Anti-TBX21 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TBX21 antibody: synthetic peptide directed towards the middle region of human TBX21. Synthetic peptide located within the following region: SIPSPPGPNCQFLGGDHYSPLLPNQYPVPSRFYPDLPGQAKDVVPQAYWL |
Rabbit polyclonal TBX21 Antibody (N-term)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This TBX21 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 22-50 amino acids from the N-terminal region of human TBX21. |
Rabbit Monoclonal T-bet Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-TBX21 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TBX21 antibody: synthetic peptide directed towards the N terminal of human TBX21. Synthetic peptide located within the following region: FYPEPGAQDADERRGGGSLGSPYPGGALVPAPPSRFLGAYAYPPRPQAAG |
Rabbit Polyclonal Anti-Tbx21 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Tbx21 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: MGIVEPGCGDMLTGTEPMPSDEGRGPGADQQHRFFYPEPGAQDPTDRRAG |
Rabbit Polyclonal Anti-TBX21 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TBX21 antibody: synthetic peptide directed towards the C terminal of mouse TBX21. Synthetic peptide located within the following region: MDPGLGSSEEQGSSPSLWPEVTSLQPESSDSGLGEGDTKRRRISPYPSSG |
TBX21 rabbit monoclonal antibody, clone MRQ-46, Supernatant
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |