HLA Class I ABC mouse monoclonal antibody, clone W6/32, Low Endotoxin
Applications | ELISA, FC, FN, IF, IHC, IP |
Reactivities | Bovine, Chimpanzee, Feline, Human, Macaque, Monkey, Primate, Baboon |
Conjugation | Unconjugated |
HLA Class I ABC mouse monoclonal antibody, clone W6/32, Low Endotoxin
Applications | ELISA, FC, FN, IF, IHC, IP |
Reactivities | Bovine, Chimpanzee, Feline, Human, Macaque, Monkey, Primate, Baboon |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-BDNF Antibody
Applications | IHC, WB |
Reactivities | Mouse, Human, Macaque |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-BDNF antibody: synthetic peptide directed towards the middle region of human BDNF. Synthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG |
Rabbit Polyclonal Anti-KCNN2 Antibody
Applications | IHC, WB |
Reactivities | Human, Rat, Macaque |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KCNN2 antibody: synthetic peptide directed towards the C terminal of human KCNN2. Synthetic peptide located within the following region: IDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNIMYDM |
MIP3 alpha / CCL20 mouse monoclonal antibody, clone 319F6.07
Applications | ELISA, FN, IHC |
Reactivities | Human, Macaque |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-KCNN2 Antibody
Applications | WB |
Reactivities | Human, Macaque |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KCNN2 antibody: synthetic peptide directed towards the middle region of human KCNN2. Synthetic peptide located within the following region: KNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQ |
Rabbit polyclonal STAT2 phospho Y690 antibody
Applications | IHC, WB |
Reactivities | Human, Chimpanzee, Macaque, Monkey, Rat, Dog, Pig, Mouse, Bovine, Horse |
Conjugation | Unconjugated |
Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to a region near the N-terminus of human STAT2 protein. |
Rabbit Polyclonal Anti-TAAR6 Antibody
Applications | IHC, WB |
Reactivities | Mouse, Human, Macaque |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TAAR6 antibody is: synthetic peptide directed towards the C-terminal region of Human TAAR6. Synthetic peptide located within the following region: YGNIFLVARRQAKKIENTGSKTESSSESYKARVARRERKAAKTLGVTVVA |
PPAR gamma (PPARG) (Isoform 1) (255 -268) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Human, Canine, Duck, Guinea Pig, Hamster, Macaque, Mink, Mouse, Rabbit, Rat, Squirrel |
Conjugation | Unconjugated |
Immunogen | Synthetic Peptide corresponding to Amino acids 255 -268 of human PPAR gamma isoform 1. |
Rabbit Polyclonal Anti-KCNN3 Antibody
Applications | IHC, WB |
Reactivities | Mouse, Human, Macaque |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KCNN3 antibody: synthetic peptide directed towards the C terminal of human KCNN3. Synthetic peptide located within the following region: ITELNDRSEDLEKQIGSLESKLEHLTASFNSLPLLIADTLRQQQQQLLSA |
Rabbit Polyclonal Anti-SPSB2 Antibody
Applications | IHC, WB |
Reactivities | Human, Macaque |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SPSB2 antibody: synthetic peptide directed towards the N terminal of human SPSB2. Synthetic peptide located within the following region: KDCSENIEVKEGGLYFERRPVAQSTDGARGKRGYSRGLHAWEISWPLEQR |
Rabbit Polyclonal Anti-SPSB2 Antibody
Applications | IHC, WB |
Reactivities | Human, Macaque |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SPSB2 antibody: synthetic peptide directed towards the C terminal of human SPSB2. Synthetic peptide located within the following region: IGRGKLYHQSKGPGAPQYPAGTQGEQLEVPERLLVVLDMEEGTLGYAIGG |
Rabbit Polyclonal Anti-ATP2A1 Antibody
Applications | IHC, WB |
Reactivities | Human, Macaque |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ATP2A1 antibody: synthetic peptide directed towards the N terminal of human ATP2A1. Synthetic peptide located within the following region: MEAAHAKTTEECLAYFGVSETTGLTPDQVKRNLEKYGLNELPAEEGKTLW |
Recombinant Anti-Fc gamma receptor III (Clone 3G8)
Applications | Bl, FC, IHC, IP |
Reactivities | Human, Chimpanzee, Baboon, Cynomolgus, Monkey, Macaque, Marmoset |
Conjugation | Unconjugated |
GDF15 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, WB |
Reactivities | Chimpanzee, Human, Macaque, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to the C-terminal sequence of NAG-1 protein. A residue of cysteine was added to facilitate coupling |
GDF15 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, WB |
Reactivities | Chimpanzee, Human, Macaque, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to the C-terminal sequence of NAG-1 protein. A residue of cysteine was added to facilitate coupling |