TRAR4 (TAAR6) Rabbit Polyclonal Antibody

CAT#: TA337761

Rabbit Polyclonal Anti-TAAR6 Antibody

Product Images

WB Suggested Anti-TAAR6 Antibody; Titration: 1.0 ug/ml; Positive Control: A549 Whole Cell

• 

  Researcher: Timur Mavlyutov, University of Wisconsin Medical School; Application: IHC; Species+tissue/cell type: Ventral horn region of mouse spinal cord; Primary antibody dilution: 1:200; Secondary antibody: Donkey anti-rabbit CY2; Secondary antibody dil

• 

  Researcher:Timur Mavlyutov, Ph. D., University of Wisconsin Medical School; Application: IHC; Species+tissue/cell type:Rhesus macaque spinal cord; Primary antibody dilution: 1:300; Secondary antibody: Donkey anti Rabbit 488; Secondary antibody dilution: 1

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: IF, WB
• Reactivities: Mouse, Human, Macaque
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TAAR6 antibody is: synthetic peptide directed towards the C-terminal region of Human TAAR6. Synthetic peptide located within the following region: YGNIFLVARRQAKKIENTGSKTESSSESYKARVARRERKAAKTLGVTVVA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 38 kDa
• Gene Name: trace amine associated receptor 6
• Database Link:
  NP_778237
  Entrez Gene 215855 MouseEntrez Gene 319100 Human
  UniProt ID Q96RI8
• Background: This gene encodes a seven-transmembrane G-protein-coupled receptor that likely functions as a receptor for endogenous trace amines. Mutations in this gene may be associated with schizophrenia.
• Synonyms: TA4; taR-4; taR-6; TAR4; TAR6; TRAR4
• Note: Immunogen Sequence Homology: Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Pig: 93%; Bovine: 93%; Guinea pig: 93%; Dog: 92%; Zebrafish: 85%

Reference Data

• Protein Families: Druggable Genome, GPCR, Transmembrane
• Protein Pathways: Neuroactive ligand-receptor interaction