Antibodies

Download

Mouse monoclonal anti-NRAS antibody (N-term)

Applications WB
Reactivities Human, Rat (Predicted: Mouse, Chicken, Pig)
Conjugation Unconjugated

Rabbit polyclonal anti-JAM3 antibody (C-term)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen This JAM3 antibody is generated from a rabbit immunized with a KLH conjugated synthetic peptide between 261-295 amino acids from the C-terminal region of human JAM3.

Rabbit Polyclonal anti-VAPA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-VAPA antibody is: synthetic peptide directed towards the C-terminal region of Human VAPA. Synthetic peptide located within the following region: RDEGLRLRKVAHSDKPGSTSTASFRDNVTSPLPSLLVVIAAIFIGFFLGK

Rabbit Polyclonal anti-CLDN7 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CLDN7 antibody: synthetic peptide directed towards the C terminal of human CLDN7. Synthetic peptide located within the following region: GPAIFIGWAGSALVILGGALLSCSCPGNESKAGYRVPRSYPKSNSSKEYV

Rabbit Polyclonal anti-EPB41 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EPB41 antibody: synthetic peptide directed towards the N terminal of human EPB41. Synthetic peptide located within the following region: SESRGLSRLFSSFLKRPKSQVSEEEGKEVESDKEKGEGGQKEIEFGTSLD

Rabbit Polyclonal anti-PARD6A antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PARD6A antibody: synthetic peptide directed towards the N terminal of human PARD6A. Synthetic peptide located within the following region: MARPQRTPARSPDSIVEVKSKFDAEFRRFALPRASVSGFQEFSRLLRAVH

Rabbit Polyclonal Anti-YBX3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CSDA antibody: synthetic peptide directed towards the C terminal of human CSDA. Synthetic peptide located within the following region: RYRSRGPPRPRPAPAVGEAEDKENQQATSGPNQPSVRRGYRRPYNYRRRP

Rabbit Polyclonal Anti-YBX3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CSDA antibody: synthetic peptide directed towards the C terminal of human CSDA. Synthetic peptide located within the following region: GPPRPRPAPAVGEAEDKENQQATSGPNQPSVRRGYRRPYNYRRRPRPPNA

Rabbit Polyclonal Anti-CDK4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CDK4 antibody: synthetic peptide directed towards the C terminal of human CDK4. Synthetic peptide located within the following region: PRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE

Rabbit Polyclonal Anti-CDC42 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CDC42 antibody: synthetic peptide directed towards the N terminal of human CDC42. Synthetic peptide located within the following region: DNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSP

Rabbit Polyclonal Anti-MYLPF Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-MYLPF antibody is: synthetic peptide directed towards the C-terminal region of Human MYLPF. Synthetic peptide located within the following region: LEELLTTQCDRFSQEEIKNMWAAFPPDVGGNVDYKNICYVITHGDAKDQE

Rabbit anti-EPB41 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human EPB41

Rabbit anti-CLDN11 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human CLDN11

Phospho-AKT1-T308 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A phospho specific peptide corresponding to residues surrounding T308 of human AKT1
Modifications Phospho-specific

Rabbit Polyclonal Anti-MYL12B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-MYL12B Antibody is: synthetic peptide directed towards the C-terminal region of Human MYL12B. Synthetic peptide located within the following region: EKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDE