MYL12B Rabbit Polyclonal Antibody

CAT#: TA333578

Rabbit Polyclonal Anti-MYL12B Antibody

Product Images

Host: Rabbit; Target Name: MYL12B; Sample Tissue: ACHN Whole Cell lysates; Antibody Dilution: 1.0 ug/ml. MYL12B is strongly supported by BioGPS gene expression data to be expressed in Human ACHN cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-MYL12B Antibody is: synthetic peptide directed towards the C-terminal region of Human MYL12B. Synthetic peptide located within the following region: EKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 20 kDa
• Gene Name: myosin light chain 12B
• Database Link:
  NP_291024
  Entrez Gene 103910 Human
  UniProt ID O14950
• Background: The activity of nonmuscle myosin II is regulated by phosphorylation of a regulatory light chain, such as MRLC2. This phosphorylation results in higher MgATPase activity and the assembly of myosin II filaments.
• Synonyms: MLC-B; MRLC2
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 86%

Reference Data

• Protein Pathways: Focal adhesion, Leukocyte transendothelial migration, Regulation of actin cytoskeleton, Tight junction