DBPA (YBX3) Rabbit Polyclonal Antibody

CAT#: TA330134

Rabbit Polyclonal Anti-YBX3 Antibody


USD 485.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (3)
Transient overexpression lysate of cold shock domain protein A (CSDA), transcript variant 1
    • 100 ug

USD 436.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00


Recombinant protein of human cold shock domain protein A (CSDA), transcript variant 1, 20 µg
    • 20 ug

USD 867.00

Other products for "DBPA"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-CSDA antibody: synthetic peptide directed towards the C terminal of human CSDA. Synthetic peptide located within the following region: GPPRPRPAPAVGEAEDKENQQATSGPNQPSVRRGYRRPYNYRRRPRPPNA
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 40 kDa
Gene Name Y-box binding protein 3
Background Human DNA-binding protein (dbpA) is a member of a Y-box binding protein family containing a cold shock domain. The increased expression of Y box binding proteins in somatic cells is associated with cell proliferation and transformation.
Synonyms CSDA; CSDA1; DBPA; ZONAB
Note Immunogen sequence homology: Bovine: 100%; Dog: 100%; Horse: 100%; Human: 100%; Pig: 100%; Rabbit: 100%; Guinea pig: 91%; Mouse: 91%; Rat: 91%
Reference Data
Protein Families Transcription Factors
Protein Pathways Tight junction

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.