Rabbit Polyclonal Anti-AICDA Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human AICDA |
Rabbit Polyclonal Anti-AICDA Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human AICDA |
Goat Polyclonal Antibody against AICDA
Applications | WB |
Reactivities | Human (Expected from sequence similarity: Pig, Cow) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence RRKFLYQFKNVR-C, from the N Terminus of the protein sequence according to NP_065712.1. |
AICDA Antibody N-terminal region
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the following sequence VKRRDSATSFSLDFGYLRNKNGCHVELLFLRYISDWDLDPGRCYRVTWFT |