Antibodies

View as table Download

Rabbit Polyclonal Anti-AICDA Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human AICDA

Goat Polyclonal Antibody against AICDA

Applications WB
Reactivities Human (Expected from sequence similarity: Pig, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence RRKFLYQFKNVR-C, from the N Terminus of the protein sequence according to NP_065712.1.

AICDA Antibody N-terminal region

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the following sequence VKRRDSATSFSLDFGYLRNKNGCHVELLFLRYISDWDLDPGRCYRVTWFT