AICDA Rabbit Polyclonal Antibody
Frequently bought together (2)
Transient overexpression lysate of activation-induced cytidine deaminase (AICDA)
USD 436.00
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
USD 200.00
Other products for "AICDA"
Specifications
Product Data | |
Applications | IHC |
Reactivities | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen is a synthetic peptide directed towards the following sequence VKRRDSATSFSLDFGYLRNKNGCHVELLFLRYISDWDLDPGRCYRVTWFT |
Specificity | Expected reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat Homology: Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100% |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Stability | Shelf life: one year from despatch. |
Predicted Protein Size | 24 kDa |
Gene Name | activation-induced cytidine deaminase |
Database Link | |
Background | This gene encodes a RNA-editing deaminase that is a member of the cytidine deaminase family. The protein is involved in somatic hypermutation, gene conversion, and class-switch recombination of immunoglobulin genes. Defects in this gene are the cause of autosomal recessive hyper-IgM immunodeficiency syndrome type 2 (HIGM2). |
Synonyms | AID; ARP2; CDA2; HIGM2 |
Reference Data | |
Protein Families | Druggable Genome |
Protein Pathways | Primary immunodeficiency |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.