STAT6 Rabbit monoclonal antibody,clone UMAB300
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
STAT6 Rabbit monoclonal antibody,clone UMAB300
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
STAT6 Rabbit monoclonal antibody,clone UMAB300
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal anti-STAT6 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-STAT6 antibody: synthetic peptide directed towards the C terminal of human STAT6. Synthetic peptide located within the following region: NLYPKKPKDEAFRSHYKPEQMGKDGRGYVPATIKMTVERDQPLPTPELQM |
STAT6 Rabbit polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human STAT6 (NP_001171550.1). |
Modifications | Unmodified |
Rabbit polyclonal STAT6 (Ab-641) antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human STAT6 around the phosphorylation site of Tyrosine 641. |
Rabbit anti-STAT6 (Phospho-Tyr641) polyclonal antibody (Phospho-specific)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanSTAT6 around the phosphorylation site of Tyrosine 641 (R-G-YP-V-P). |
Modifications | Phospho-specific |
Rabbit polyclonal STAT6 phospho Y641 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | STAT6 phospho Y641 Antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to residues surrounding Y641 of human STAT6 protein. |
Rabbit Polyclonal STAT6 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human STAT6 |
Rabbit Polyclonal STAT6 (Tyr641) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human STAT6 around the phosphorylation site of Tyrosine 641 |
Modifications | Phospho-specific |
Rabbit Polyclonal STAT6 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human STAT6 |
Rabbit Polyclonal STAT6 (Thr645) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human STAT6 around the phosphorylation site of Threonine 645 |
Modifications | Phospho-specific |
Phospho-STAT6-Y641 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A phospho specific peptide corresponding to residues surrounding Y641 of human STAT6 |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-STAT6 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human STAT6 |
Rabbit anti-STAT6 (Phospho-Thr645) polyclonal antibody (Phospho-specific)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanSTAT6 around the phosphorylation site of threonine 645 (P-A-TP-I-K). |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-STAT6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-STAT6 antibody: synthetic peptide directed towards the C terminal of human STAT6. Synthetic peptide located within the following region: TEQDLTKLLLEGQGESGGGSLGAQPLLQPSHYGQSGISMSHMDLRANPSW |