Antibodies

View as table Download

Rabbit Polyclonal antibody to GAPDH (glyceraldehyde-3-phosphate dehydrogenase)

Applications IF, IHC, WB
Reactivities Human, Mouse (Predicted: Feline, Chicken, Dog, Drosophila, Monkey, Pig, Rabbit, Xenopus, Zebrafish, Bovine)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 335 of GAPDH (Uniprot ID#P04406)

Rabbit Polyclonal antibody to alpha Tubulin 1A (tubulin, alpha 1a)

Applications IF, IHC, WB
Reactivities Human, Drosophila, Rat, Mouse (Predicted: Chimpanzee, Bovine, Rhesus Monkey)
Conjugation Unconjugated
Immunogen Recombinant protein fragment contain a sequence corresponding to a region within amino acids 37 and 276 of alpha Tubulin 1A

Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody

Applications Dot, WB
Reactivities Human (Predicted: Mouse, Rat, Drosophila)
Conjugation Unconjugated
Immunogen This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2.
Modifications Phospho-specific

Rabbit polyclonal FOXG1 Antibody (Center)

Applications FC, IF, WB
Reactivities Human, Mouse (Predicted: Rat, Chicken, Drosophila, Xenopus)
Conjugation Unconjugated
Immunogen This FOXG1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 225-252 amino acids from the Central region of human FOXG1.

Rabbit polyclonal ATP6V1B1 Antibody (Center)

Applications IF, IHC, WB
Reactivities Human (Predicted: Mouse, Rat, Bovine, Chicken, Drosophila, C. elegans)
Conjugation Unconjugated
Immunogen This ATP6V1B1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 284-310 amino acids from the Central region of human ATP6V1B1.

Mouse monoclonal Hsp70 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat, Bovine, Canine, Chicken, Carp, Monkey, Pig, Rabbit, Sheep, Hamster, Guinea Pig, C. elegans, Drosophila
Conjugation Unconjugated

Rabbit polyclonal SMAD2 Antibody

Applications FC, IF, WB
Reactivities Human, Mouse (Predicted: Rat, Zebrafish, Bovine, Chicken, Drosophila, Pig)
Conjugation Unconjugated
Immunogen This SMAD2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 97-125 amino acids from human SMAD2.

G0 Protein alpha (GNAO1) (345-354) rabbit polyclonal antibody, Ig Fraction

Applications ELISA, IHC, WB
Reactivities Mouse, Drosophila
Conjugation Unconjugated
Immunogen Synthetic peptide KLH- conjugated corresponding to amino acids 345-354 of the native molecule

Rabbit Polyclonal Anti-TUBE1 Antibody - middle region

Applications IHC, WB
Reactivities Drosophila, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TUBE1 antibody: synthetic peptide directed towards the middle region of human TUBE1. Synthetic peptide located within the following region: HLHHYLQVEGMEESCFTEAVSSLSALIQEYDQLDATKNMPVQDLPRLSIA

His2Av pSer137 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, WB
Reactivities Drosophila
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acids 132-141 of Drosophila melanogaster (fruit fly) H2AvD protein.

Rabbit Polyclonal Anti-TPI1 Antibody

Applications WB
Reactivities Human, Drosophila
Conjugation Unconjugated
Immunogen The immunogen for anti-TPI1 antibody: synthetic peptide directed towards the N terminal of human TPI1. Synthetic peptide located within the following region: MAPSRKFFVGGNWKMNGRKQSLGELIGTLNAAKVPADTEVVCAPPTAYID

HIST4H4 (acetyl K5) rabbit polyclonal antibody, Serum

Applications ChIP, ELISA, IF, IP, WB
Reactivities Amphibian, Drosophila, Mammalian, Plant, Yeast
Conjugation Unconjugated
Immunogen Ovalbumin-conjugated peptide.

Rabbit polyclonal Hsp 90 alpha antibody

Applications WB
Reactivities Human, Mouse, Rat, Monkey, Chicken, Drosophila
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 289-300 of human Hsp90 protein.

Mouse Monoclonal Anti-beta-Actin Antibody [10B7]

Applications ELISA, WB
Reactivities Human, Mouse, Rat, Rabbit, Zebrafish, Chicken, Drosophila
Conjugation Unconjugated

Mouse Monoclonal anti-HSPA1A Antibody

Applications FC
Reactivities Human, Mouse, Rat, Bovine, Dog, Chicken, Drosophila, Fish, Monkey, Porcine, Rabbit, Sheep, Hamster, Guinea Pig
Conjugation Unconjugated