Rabbit Polyclonal Anti-AATF Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AATF antibody: synthetic peptide directed towards the N terminal of human AATF. Synthetic peptide located within the following region: MAGPQPLALQLEQLLNPRPSEADPEADPEEATAARVIDRFDEGEDGEGDF |
Rabbit Polyclonal Anti-AATF Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AATF antibody: synthetic peptide directed towards the C terminal of human AATF. Synthetic peptide located within the following region: PNDQVAMGRQWLAIQKLRSKIHKKVDRKASKGRKLRFHVLSKLLSFMAPI |
Rabbit Polyclonal Anti-DUX5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DUX5 antibody: synthetic peptide directed towards the C terminal of human DUX5. Synthetic peptide located within the following region: IAAREELARETGLPESRIQIWFQNRRARHRGQSGRAPTQASIRCNAAPIG |
Rabbit Polyclonal Anti-FOXB1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FOXB1 antibody: synthetic peptide directed towards the N terminal of human FOXB1. Synthetic peptide located within the following region: MPRPGRNTYSDQKPPYSYISLTAMAIQSSPEKMLPLSEIYKFIMDRFPYY |
Rabbit Polyclonal Anti-SCML4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SCML4 antibody is: synthetic peptide directed towards the C-terminal region of Human SCML4. Synthetic peptide located within the following region: EDVVWFVKDADPQALGPHVELFRKHEIDGNALLLLKSDMVMKYLGLKLGP |
Rabbit Polyclonal Anti-HBP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HBP1 antibody: synthetic peptide directed towards the N terminal of human HBP1. Synthetic peptide located within the following region: MVWEVKTNQMPNAVQKLLLVMDKRASGMNDSLELLQCNENLPSSPGYNSC |
Rabbit Polyclonal Anti-HBP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HBP1 antibody: synthetic peptide directed towards the middle region of human HBP1. Synthetic peptide located within the following region: SVILGDRWKKMKNEERRMYTLEAKALAEEQKRLNPDCWKRKRTNSGSQQH |
Rabbit Polyclonal Anti-HEY2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HEY2 antibody: synthetic peptide directed towards the middle region of human HEY2. Synthetic peptide located within the following region: PMLPPNAAAAVAAATAISPPLSVSATSSPQQTSSGTNNKPYRPWGTEVGA |
Rabbit Polyclonal Anti-MAFF Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAFF antibody: synthetic peptide directed towards the N terminal of human MAFF. Synthetic peptide located within the following region: SVRELNRHLRGLSAEEVTRLKQRRRTLKNRGYAASCRVKRVCQKEELQKQ |
Rabbit Polyclonal Anti-MYST4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MYST4 antibody: synthetic peptide directed towards the N terminal of human MYST4. Synthetic peptide located within the following region: MVKLANPLYTEWILEAIQKIKKQKQRPSEERICHAVSTSHGLDKKTVSEQ |
Rabbit Polyclonal Anti-ZNF281 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF281 antibody: synthetic peptide directed towards the middle region of human ZNF281. Synthetic peptide located within the following region: PMTFITNSNGEVDHRVRTSVSDFSGYTNMMSDVSEPCSTRVKTPTSQSYR |
Rabbit Polyclonal Anti-C16orf80 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C16orf80 antibody: synthetic peptide directed towards the middle region of human C16orf80. Synthetic peptide located within the following region: AYGTNYIETLRVQIHANCRIRRVYFSDRLYSEDELPAEFKLYLPVQNKAK |
Rabbit Polyclonal Anti-ZNF214 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF214 antibody: synthetic peptide directed towards the C terminal of human ZNF214. Synthetic peptide located within the following region: PYQCAKCGKGFSHSSALRIHQRVHAGEKPYKCREYYKGFDHNSHLHNNHR |
Rabbit Polyclonal Anti-ZNF215 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF215 antibody: synthetic peptide directed towards the N terminal of human ZNF215. Synthetic peptide located within the following region: MQPLSKLMAISKPRNLSLREQREVLRADMSWQQETNPVVETHDSEASRQK |
Rabbit Polyclonal Anti-SAP30BP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SAP30BP antibody: synthetic peptide directed towards the C terminal of human SAP30BP. Synthetic peptide located within the following region: IEFVTGTKKGTTTNATSTTTTTASTAVADAQKRKSKWDSAIPVTTIAQPT |
Germany
Japan
United Kingdom
China