SDS mouse monoclonal antibody, clone OTI3D3 (formerly 3D3)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
SDS mouse monoclonal antibody, clone OTI3D3 (formerly 3D3)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-CBS Antibody
Applications | IHC, WB |
Reactivities | Human, Rat, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CBS antibody: synthetic peptide directed towards the N terminal of human CBS. Synthetic peptide located within the following region: RCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNE |
Rabbit Polyclonal antibody to Glycine dehydrogenase (glycine dehydrogenase (decarboxylating))
Applications | IF, IHC, WB |
Reactivities | Human (Predicted: Mouse, Chicken, Rat, Xenopus, Bovine) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 442 and 723 of Glycine dehydrogenase (Uniprot ID#P23378) |
Rabbit anti-SHMT2 Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human SHMT2 |