Antibodies

View as table Download

Rabbit Polyclonal HIF-2 alpha Antibody

Applications ChIP, ELISA, FC, ICC/IF, IHC, Immunoblotting, IP, SDS-PAGE, Simple Western, WB
Reactivities Fish, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A peptide derived from the C-terminus of mouse/human HIF-2 alpha protein.

Collagen IV (COL4A1) rabbit polyclonal antibody, Serum

Applications ELISA, IHC, WB
Reactivities Canine, Feline, Fish, Human, Mouse, Porcine, Rat
Conjugation Unconjugated
Immunogen Human placental type IV Collagen.

Hsp40 (DNAJB1) rabbit polyclonal antibody, Purified

Applications IHC, IP, WB
Reactivities Bovine, Canine, Chicken, Fish, Guinea Pig, Hamster, Human, Monkey, Mouse, Porcine, Rabbit, Rat, Sheep, Xenopus
Conjugation Unconjugated
Immunogen Recombinant human Hsp40 protein

Rabbit Polyclonal Anti-OMA1 Antibody

Applications WB
Reactivities Human, Fish
Conjugation Unconjugated
Immunogen The immunogen for anti-OMA1 antibody: synthetic peptide directed towards the middle region of human OMA1. Synthetic peptide located within the following region: WAICPRDSLALLCQWIQSKLQEYMFNRPYSRKLEAEADKIGLLLAAKACA

gamma Tubulin Rabbit polyclonal Antibody

Applications FC, IF, IHC, IP, WB
Reactivities Human, Mouse, Rat, Monkey, Chicken, Hamster, Cow, Dog, Fish, Xenopus
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human Tubulin gamma

Rabbit Polyclonal anti-CALR Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat, Bovine, Dog, Chicken, Drosophila, Fish, Monkey, Porcine, Rabbit, Sheep, Hamster, Guinea Pig
Conjugation Unconjugated
Immunogen Human calreticulin synthetic peptide with a cysteine residue added and the peptide conjugated to KLH

EIF3F (114-125) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IF, IHC, IP, WB
Reactivities Bovine, Chicken, Human, Mouse, Rat, Drosophila, Fish, Monkey
Conjugation Unconjugated
Immunogen Synthetic peptide from aa 114-125 of human EIF3F

Rabbit polyclonal anti-ATR antibody

Applications WB
Reactivities Human, Mouse, Monkey, Dog, Xenopus, Rat, Fish
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of human ATR protein.

USD 325.00

3 Weeks

Tubulin β (4D9) monoclonal antibody

Applications WB
Reactivities Human, Mouse, Rabbit, Frog, Fish, Chicken, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 402-455 of Human Tubulin β.

PROX1 (C-term) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Fish, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide corresponding to the Homeobox domain of Prox1.

Rabbit polyclonal anti-PCNA antibody

Applications WB
Reactivities Human, Monkey, Dog, Mouse, Bovine, Xenopus, Rat, Chicken, Fish
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of human PCNA protein.

USD 325.00

3 Weeks

Tubulin β (4D9) monoclonal antibody-HRP

Applications WB
Reactivities Human, Mouse, Rabbit, Frog, Fish, Chicken, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 402-455 of Human Tubulin β.

Acetylcholinesterase rabbit polyclonal antibody, Aff - Purified

Applications ELISA, WB
Reactivities Fish, Human
Conjugation Unconjugated
Immunogen Highly purified Acetylcholine Esterase from Electrophorus electricus.

Anti-Connexin 35/36 (Ser276) Antibody

Applications IHC, WB
Reactivities Fish, Mouse, Rabbit
Conjugation Unconjugated
Immunogen Synthetic phospho-peptide corresponding to amino acid residues of perch connexin 35/36 surrounding Ser276, conjugated to keyhole limpet hemocyanin (KLH).