Rabbit Polyclonal Anti-WNT1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT1 antibody: synthetic peptide directed towards the middle region of human WNT1. Synthetic peptide located within the following region: FGREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTV |
Rabbit polyclonal anti-BMP2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human BMP2 |
Goat Polyclonal Antibody against SMO (Internal region)
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Zebrafish) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QSDDEPKRIKKS, from the internal region of the protein sequence according to NP_005622.1. |
Rabbit polyclonal antibody to Dhh (desert hedgehog homolog (Drosophila))
| Applications | WB |
| Reactivities | Human (Predicted: Mouse, Rat) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 135 and 396 of Dhh (Uniprot ID#O43323) |
Rabbit polyclonal anti-SMO antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SMO. |
Rabbit polyclonal CK-1a (Tyr294) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CK-1a around the phosphorylation site of tyrosine 294 (Y-D-YP-T-F). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-Wnt1 antibody
| Applications | WB |
| Reactivities | Mouse, Human, Bovine, Dog, Macaque, Rat, Opossum |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of human Wnt1 protein. |
Rabbit Polyclonal Anti-Wnt8b Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Wnt8b Antibody is: synthetic peptide directed towards the C-terminal region of Mouse Wnt8b. Synthetic peptide located within the following region: IADTFRSISTRELVHLEDSPDYCLENKTLGLLGTEGRECLRRGRALGRWE |
Rabbit Polyclonal Anti-DHH Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Dhh antibody is: synthetic peptide directed towards the N-terminal region of Mouse Dhh. Synthetic peptide located within the following region: FRDLVPNYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMNMWPGVRL |
Rabbit Polyclonal Anti-WNT8B Antibody - C-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Wnt8b antibody is: synthetic peptide directed towards the C-terminal region of Mouse Wnt8b. Synthetic peptide located within the following region: SISTRELVHLEDSPDYCLENKTLGLLGTEGRECLRRGRALGRWERRSCRR |
Rabbit Polyclonal Anti-Patched Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Patched Antibody: A synthesized peptide derived from human Patched |
Rabbit polyclonal anti-BMP2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human BMP2 |
Germany
Japan
United Kingdom
China
