Antibodies

View as table Download

PTF1A mouse monoclonal antibody,clone OTI1H6

Applications WB
Reactivities Human, Rat, Mouse
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PTF1A mouse monoclonal antibody,clone OTI1H6

Applications WB
Reactivities Human, Rat, Mouse
Conjugation Unconjugated

PTF1A mouse monoclonal antibody,clone OTI3G1

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PTF1A mouse monoclonal antibody,clone OTI3G1

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PTF1A mouse monoclonal antibody,clone OTI3G1, Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

PTF1A mouse monoclonal antibody,clone OTI3G1, HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

PTF1A mouse monoclonal antibody,clone OTI1H6

Applications WB
Reactivities Human, Rat, Mouse
Conjugation Unconjugated

PTF1A mouse monoclonal antibody,clone OTI5E5

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PTF1A mouse monoclonal antibody,clone OTI5E5

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Goat Polyclonal Antibody against PTF1A

Applications WB
Reactivities Human, Mouse (Expected from sequence similarity: Rat, Dog, Zebrafish)
Conjugation Unconjugated
Immunogen Peptide with sequence C-WTDEKQLKEQN, from the internal region of the protein sequence according to NP_835455.1.

Rabbit Polyclonal anti-PTF1A antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PTF1A antibody: synthetic peptide directed towards the N terminal of human PTF1A. Synthetic peptide located within the following region: MDAVLLEHFPGGLDAFPSSYFDEDDFFTDQSSRDPLEDGDELLADEQAEV

Rabbit Polyclonal Anti-PTF1A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PTF1A antibody: synthetic peptide directed towards the N terminal of human PTF1A. Synthetic peptide located within the following region: PLEDGDELLADEQAEVEFLSHQLHEYCYRDGACLLLQPAPPAAPLALAPP

Rabbit Polyclonal Anti-Ptf1a Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Ptf1a antibody is: synthetic peptide directed towards the N-terminal region of Mouse Ptf1a. Synthetic peptide located within the following region: FPSPYFDEEDFFTDQSSRDPLEDSDELLGDEQAEVEFLSHQLHEYCYRDG