PTF1A Rabbit Polyclonal Antibody

CAT#: TA342326

Rabbit Polyclonal Anti-Ptf1a Antibody

Product Images

Host: Rabbit; Target Name: Ptf1a; Sample Tissue: Mouse Testis lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Ptf1a antibody is: synthetic peptide directed towards the N-terminal region of Mouse Ptf1a. Synthetic peptide located within the following region: FPSPYFDEEDFFTDQSSRDPLEDSDELLGDEQAEVEFLSHQLHEYCYRDG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 35 kDa
• Gene Name: pancreas specific transcription factor, 1a
• Database Link:
  NP_835455
  Entrez Gene 19213 Mouse
  UniProt ID Q7RTS3
• Background: Ptf1a is a transcriptional activator. It binds to the E-box consensus sequence 5'-CANNTG-3' and may play a role in early and late pancreas development and differentiation. Ptf1a plays an important role in determining whether cells allocated to the pancreatic buds continue towards pancreatic organogenesis or revert back to duodenal fates and may be involved in the maintenance of exocrine pancreas-specific gene expression including ELA1 and amylase. It is required for the formation of pancreatic acinar and ductal cells. and plays an important role in cerebellar development.
• Synonyms: bHLHa29; PACA; PAGEN2; PTF1-p48
• Note: Immunogen Sequence Homology: Mouse: 100%; Pig: 93%; Rat: 93%; Human: 93%; Bovine: 93%; Horse: 92%; Dog: 86%

Reference Data

• Protein Families: Embryonic stem cells, ES Cell Differentiation/IPS