PTF1A Rabbit Polyclonal Antibody
Frequently bought together (2)
Transient overexpression lysate of pancreas specific transcription factor, 1a (PTF1A)
USD 436.00
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
USD 200.00
Other products for "PTF1A"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Mouse |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-Ptf1a antibody is: synthetic peptide directed towards the N-terminal region of Mouse Ptf1a. Synthetic peptide located within the following region: FPSPYFDEEDFFTDQSSRDPLEDSDELLGDEQAEVEFLSHQLHEYCYRDG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 35 kDa |
Gene Name | pancreas specific transcription factor, 1a |
Database Link | |
Background | Ptf1a is a transcriptional activator. It binds to the E-box consensus sequence 5'-CANNTG-3' and may play a role in early and late pancreas development and differentiation. Ptf1a plays an important role in determining whether cells allocated to the pancreatic buds continue towards pancreatic organogenesis or revert back to duodenal fates and may be involved in the maintenance of exocrine pancreas-specific gene expression including ELA1 and amylase. It is required for the formation of pancreatic acinar and ductal cells. and plays an important role in cerebellar development. |
Synonyms | bHLHa29; PACA; PAGEN2; PTF1-p48 |
Note | Immunogen Sequence Homology: Mouse: 100%; Pig: 93%; Rat: 93%; Human: 93%; Bovine: 93%; Horse: 92%; Dog: 86% |
Reference Data | |
Protein Families | Embryonic stem cells, ES Cell Differentiation/IPS |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.