Mouse Monoclonal p53 Antibody (PAb 240)
Applications | CyTOF-ready, ELISA, FC, ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat, Yeast (Does not react with: Xenopus) |
Conjugation | Unconjugated |
Mouse Monoclonal p53 Antibody (PAb 240)
Applications | CyTOF-ready, ELISA, FC, ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat, Yeast (Does not react with: Xenopus) |
Conjugation | Unconjugated |
Rabbit Polyclonal Bax Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Mouse Monoclonal iNOS Antibody (4E5)
Applications | ELISA, FC, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Mouse Monoclonal eNOS Antibody (6H2)
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-Human sTNF Receptor Type I Rabbit Polyclonal Antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human sTNF Receptor Type I |
Rabbit Polyclonal ASK1 Antibody
Applications | ELISA, ICC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | ASK1 antibody was raised against a peptide corresponding to amino acids near the carboxy terminus of human ASK1 This sequence is different from that of mouse by last two amino acids. |
Rabbit Polyclonal anti-TP53 antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE |
Rabbit Polyclonal anti-TP53 antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: PSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAP |
TNF alpha (TNF) mouse monoclonal antibody, clone Mab1, Purified
Applications | ELISA, FN, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal eNOS Antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
BID (1-195) mouse monoclonal antibody, clone 4D3, Purified
Applications | ELISA, FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
BID (1-195) mouse monoclonal antibody, clone 4D3, Purified
Applications | ELISA, FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
BCL2 (1-211) mouse monoclonal antibody, clone AT1B5, Purified
Applications | ELISA, FC, IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
BCL2 (1-211) mouse monoclonal antibody, clone AT1B5, Purified
Applications | ELISA, FC, IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Rabbit Polyclonal eNOS Antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |