Antibodies

View as table Download

Mouse Monoclonal p53 Antibody (PAb 240)

Applications CyTOF-ready, ELISA, FC, ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat, Yeast (Does not react with: Xenopus)
Conjugation Unconjugated

Rabbit Polyclonal Bax Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Mouse Monoclonal iNOS Antibody (4E5)

Applications ELISA, FC, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
TA336918 is a replacement of AM06772PU-N.

Mouse Monoclonal eNOS Antibody (6H2)

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
TA336799 is a replacement of AM06374SU-N.

Anti-Human sTNF Receptor Type I Rabbit Polyclonal Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human sTNF Receptor Type I

Rabbit Polyclonal ASK1 Antibody

Applications ELISA, ICC, IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen ASK1 antibody was raised against a peptide corresponding to amino acids near the carboxy terminus of human ASK1 This sequence is different from that of mouse by last two amino acids.

Rabbit Polyclonal anti-TP53 antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE

Rabbit Polyclonal anti-TP53 antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: PSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAP

TNF alpha (TNF) mouse monoclonal antibody, clone Mab1, Purified

Applications ELISA, FN, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal eNOS Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

BID (1-195) mouse monoclonal antibody, clone 4D3, Purified

Applications ELISA, FC, IF, WB
Reactivities Human
Conjugation Unconjugated

BID (1-195) mouse monoclonal antibody, clone 4D3, Purified

Applications ELISA, FC, IF, WB
Reactivities Human
Conjugation Unconjugated

BCL2 (1-211) mouse monoclonal antibody, clone AT1B5, Purified

Applications ELISA, FC, IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated

BCL2 (1-211) mouse monoclonal antibody, clone AT1B5, Purified

Applications ELISA, FC, IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated

Rabbit Polyclonal eNOS Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.