Antibodies

View as table Download

Rabbit Polyclonal Anti-KV11.1 (HERG) (extracellular)

Applications FC, IF, IHC, IP, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Peptide AFLLKETEEGPPATEC corresponding to residues 430-445 of human KV11.1 (HERG). Extracellular, between S1 and S2 domains.

Rabbit Polyclonal Anti-KCNJ12 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNJ12 antibody: synthetic peptide directed towards the middle region of human KCNJ12. Synthetic peptide located within the following region: KDLVENKFLLPSANSFCYENELAFLSRDEEDEADGDQDGRSRDGLSPQAR

Rabbit Polyclonal Anti-KCNG4 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human KCNG4

Rabbit Polyclonal Anti-KCNK13 Antibody

Applications IHC, WB
Reactivities Human, Dog
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNK13 antibody: synthetic peptide directed towards the C terminal of human KCNK13. Synthetic peptide located within the following region: GEMISMKDLLAANKASLAILQKQLSEMANGCPHQTSTLARDNEFSGGVGA

Rabbit Polyclonal Anti-KCNQ5 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human KCNQ5

Rabbit Polyclonal Anti-KCNA7 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human KCNA7

Rabbit Polyclonal Anti-KCND1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human KCND1

Rabbit Polyclonal Anti-KCNG2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human KCNG2

Rabbit Polyclonal Anti-KCNK9 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human KCNK9

Rabbit Polyclonal Anti-KCNQ4 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human KCNQ4

Rabbit Polyclonal Anti-KCNN4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNN4 antibody: synthetic peptide directed towards the C terminal of human KCNN4. Synthetic peptide located within the following region: DLQQNLSSSHRALEKQIDTLAGKLDALTELLSTALGPRQLPEPSQQSK

Rabbit Polyclonal Anti-KCNJ9 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human KCNJ9

Anti-KCNC2 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 16-30 amino acids of Human potassium voltage-gated channel, Shaw-related subfamily, member 2

Rabbit Polyclonal Anti-KV1.3 (extracellular)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide KDYPASTSQDSFEA(C), corresponding to amino acid residues 263-276 of human Kv1.3.Extracellular loop between domains S1 and S2.

Rabbit Polyclonal Anti-KCNMA1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNMA1 antibody: synthetic peptide directed towards the c terminal region of human KCNMA1. Synthetic peptide located within the following region: CFGIYRLRDAHLSTPSQCTKRYVITNPPYEFELVPTDLIFCLMQFDHNAG