Kir2.2 (KCNJ12) Rabbit Polyclonal Antibody

CAT#: TA338595

Rabbit Polyclonal Anti-KCNJ12 Antibody

Product Images

WB Suggested Anti-KCNJ12 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Human brain

• 

  Host: Rabbit; Target Name: KCNJ12; Sample Tissue: Human Fetal Pancreas; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: KCNJ12; Sample Tissue: Human Fetal Stomach; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: KCNJ12; Sample Tissue: Human Adult Placenta; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: KCNJ12; Sample Tissue: Human Fetal Muscle; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: KCNJ12; Sample Tissue: Human Fetal Liver; Antibody Dilution: 1.0 ug/ml

• Host: Rabbit; Target Name: KCNJ12; Sample Tissue: Human Fetal Lung; Antibody Dilution: 1.0 ug/ml

• Host: Rabbit; Target Name: KCNJ12; Sample Tissue: Human Fetal Heart; Antibody Dilution: 1.0 ug/ml

• Host: Rabbit; Target Name: KCNJ12; Sample Tissue: Human Fetal Brain; Antibody Dilution: 1.0 ug/ml

Show all 9 images

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-KCNJ12 antibody: synthetic peptide directed towards the middle region of human KCNJ12. Synthetic peptide located within the following region: KDLVENKFLLPSANSFCYENELAFLSRDEEDEADGDQDGRSRDGLSPQAR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 49 kDa
• Gene Name: potassium voltage-gated channel subfamily J member 12
• Database Link:
  NP_066292
  Entrez Gene 3768 Human
  UniProt ID Q14500
• Background: This gene encodes an inwardly rectifying K+ channel which may be blocked by divalent cations. This protein is thought to be one of multiple inwardly rectifying channels which contribute to the cardiac inward rectifier current (IK1). The gene is located within the Smith-Magenis syndrome region on chromosome 17. [provided by RefSeq, Jul 2008]
• Synonyms: hIRK; hIRK1; hkir2.2x; IRK-2; IRK2; kcnj12x; KCNJN1; Kir2.2; Kir2.2v
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Bovine: 93%

Reference Data

• Protein Families: Druggable Genome, Ion Channels: Potassium, Transmembrane