Antibodies

View as table Download

GBA mouse monoclonal antibody, clone OTI1D8 (formerly 1D8)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit polyclonal antibody to beta-glucosidase (glucosidase, beta; acid (includes glucosylceramidase))

Applications IHC, WB
Reactivities Human (Predicted: Chimpanzee)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 65 and 384 of GBA (Uniprot ID#P04062)

Rabbit Polyclonal Antibody against FUCA2 (N-term)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This FUCA2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 138-167 amino acids from the N-terminal region of human FUCA2.

Rabbit Polyclonal Anti-HEXA Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HEXA antibody: synthetic peptide directed towards the C terminal of human HEXA. Synthetic peptide located within the following region: WKDFYIVEPLAFEGTPEQKALVIGGEACMWGEYVDNTNLVPRLWPRAGAV

GBA mouse monoclonal antibody, clone OTI2B2 (formerly 2B2)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit anti-GLB1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human GLB1

NEU2 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the following sequence SGAHAYRIPALLYLPGQQSLLAFAEQRASKKDEHAELIVLRRGDYDAPTH

GLB1 mouse monoclonal antibody, clone OTI1E10 (formerly 1E10)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated